PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr012310.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 245aa    MW: 26338.2 Da    PI: 8.497
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr012310.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.18.7e-183479147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEd  l ++v ++G+++W++I+r++  gR++k+c++rw + 
      Pbr012310.1 34 KGPWSAEEDRVLTQLVDRYGPRNWSLISRYIK-GRSGKSCRLRWCNQ 79
                     79*****************************9.***********985 PP

2Myb_DNA-binding53.36.2e-1788130347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++++ Ede ++ a++++G++ W+tIar ++ gRt++ +k++w++ 
      Pbr012310.1  88 PFSQAEDETILAAHARFGNR-WATIARLLP-GRTDNAVKNHWNST 130
                      79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.3182984IPR017930Myb domain
SuperFamilySSF466896.83E-3131127IPR009057Homeodomain-like
SMARTSM007173.0E-153382IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.8E-243587IPR009057Homeodomain-like
CDDcd001676.11E-143678No hitNo description
PfamPF139216.5E-173795No hitNo description
SMARTSM007171.8E-1485133IPR001005SANT/Myb domain
PROSITE profilePS5129420.59785135IPR017930Myb domain
CDDcd001674.05E-1188131No hitNo description
Gene3DG3DSA:1.10.10.601.0E-2288134IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MEAMNMCSSS TSSSGTSSSE SSLPRNPNKP ERIKGPWSAE EDRVLTQLVD RYGPRNWSLI  60
SRYIKGRSGK SCRLRWCNQL SPSVQHRPFS QAEDETILAA HARFGNRWAT IARLLPGRTD  120
NAVKNHWNST LKRRVMGDQL TEGGSFGGGG GGGGNVGSNE GMSTSSVSGS LANGSMEFDP  180
LTELTLAPPG IGSGSGGAMV GEQQRNNESV PSGFWDSMRD MIAREVRDYV ATTVSEPSEL  240
HRLN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C5e-443013554159MYB PROTO-ONCOGENE PROTEIN
1h89_C5e-443013554159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009370160.11e-179PREDICTED: transcriptional activator Myb-like
TrEMBLM5XHQ51e-126M5XHQ5_PRUPE; Uncharacterized protein
STRINGPOPTR_0002s13030.12e-93(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF50743256
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.11e-57myb domain protein 73